DPCstruct | MC23842
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 88 ± 9 aa |
| Standard deviation of domain lengths | 8.71 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 76.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.66 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 34.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03457 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K1FWX3 | 309-390 | VSEEQRRPAGFQLDDDRWLVRLAELLEFVDQEGRLPVQSLSAPAEERRLSYWLSNQRAEHKCRLLAGHRIDELNQKLPGWGS |
| A0A7K1FKI8 | 9-94 | GVDPQRSRRGFQRDDTRWMQQLTAVAAHVERTGRLPSASRNADPQERPLGVWLTNQRRDHLIGSMPVDRVARLDALVPTWAGKSGP |
| A0A1I7DGW6 | 27-115 | None |
| A0A0Q9LL18 | 1-92 | None |
| A0A2J8GJB8 | 121-215 | None |
| A0A0M3UFR7 | 114-193 | None |
| A0A7K1FW89 | 1-102 | None |
| A0A7K1FTP8 | 78-171 | None |
| A0A1H9HBS4 | 126-205 | None |
| A0A7K1FNR3 | 126-224 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.