DPCstruct | MC23838
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 119 ± 11 aa |
| Standard deviation of domain lengths | 11.38 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 65.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 42.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K1FF03 | 1-122 | MAVERPRRVRVVLADRRPAPAPVPPEDEVREQTEVGRLLVRGLMRAQLALALRLAAIAVLGVGTWPALFAVVPGLAEMRWLGVPLPW… |
| A0A535UMQ4 | 11-109 | AGRRLRDLLEQTQVGTVFLSALMRRQLRLSLAITAAFLVGLGVQPLLPEIWPSYGDTSVLGLPLPWLVLGVLTYPGLVVLGLLYVRR… |
| F4CIN3 | 404-518 | None |
| A0A4U2YTV2 | 1-120 | None |
| A0A136PW42 | 2-134 | None |
| A0A4R2R2Z7 | 100-221 | None |
| A0A1H0A491 | 43-164 | None |
| A0A6J4PRV7 | 160-288 | None |
| A0A4Q7UTL4 | 546-681 | None |
| A0A7Y5T8G2 | 4-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.