DPCstruct | MC23837
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 329 ± 47 aa |
| Standard deviation of domain lengths | 47.10 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 29.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18934 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N8Q6K7 | 24-357 | TRWIGWAMQQNDGDVLVVCGGWHAPALAKMWRECPQEINKPELPSLADAVTGCYLTPYSEKRLDVLAGYLSGMPAPVWQNWCWQWGL… |
| A4YLI0 | 178-457 | HGPEIFAALEAAIAALRETIDPLPYQPADEAQRELRREAHMRLEIAAALSAQDDPVAVVCGAWHVPALRRKVALKDDRALLKGLPQI… |
| A0A066Z0L2 | 168-488 | None |
| A0A6B1L413 | 195-545 | None |
| A0A535E5U7 | 97-408 | None |
| A0A6I1YKG1 | 264-560 | None |
| A0A376U6X3 | 1-334 | None |
| A0A376TD78 | 16-283 | None |
| A0A376RYA1 | 157-539 | None |
| A0A521U4N6 | 172-565 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.