DPCstruct | MC23834
Metacluster Properties and Pfam Annotations
| Number of structural domains | 125 |
|---|---|
| Mean domain length (aa) | 218 ± 35 aa |
| Standard deviation of domain lengths | 34.70 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 87.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 26.02 |
| Pfam Score | 85.37 |
| Assigned Pfam label(s) | CL0260- CL0198- PF17657 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X8FF89 | 9-167 | LTIIGDAIENIEANRGIDLDLESLPLDDKPTYELLGRGETLGVFQLDGGPMRDLLRRMQPTEFNDIVAVLALYRPGPMGMNAHNDYA… |
| A0A6N8Q5C1 | 5-228 | LGLRTLTIINWALEMINKRRAKNGEPPLDIAAIPLDDKKSFDMLQRSETTAVFQLESRGMKDLIKRLQPDCFEDMIALVALFRPGPL… |
| R5FW09 | 104-308 | None |
| A0A3B0B0L2 | 500-741 | None |
| A0A3N5X9S5 | 446-679 | None |
| A0A6M0EMX7 | 522-728 | None |
| A0A0G1XS63 | 115-301 | None |
| A0A6G8FWJ1 | 355-576 | None |
| A0A3S4ID54 | 6-216 | None |
| W7C9X8 | 17-236 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.