DPCstruct | MC23833
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 175 ± 23 aa |
| Standard deviation of domain lengths | 22.65 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 25.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13084 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H6AMH5 | 49-243 | NTVDLTLKKEALYIKLGKEKTLGSDTDDFIRSSLLAYSFIWMERVYISPSNFRKLITTSFPEYLYNITGWQGCRGAKARRGLCSPKR… |
| A0A3M1TKV4 | 157-317 | RNFPRASLELTVGLGLFLAWYLTATEVNAPDWQYQTFPESLRAKFVTFEGWRFDDNAIHLNSPGHALAGVGYHQVARANGLSVAEGL… |
| A0A1W9GLX7 | 4-143 | None |
| A0A534NR72 | 47-226 | None |
| A0A7V3UI84 | 29-208 | None |
| A0A809RGZ5 | 39-191 | None |
| A0A534W5E7 | 17-186 | None |
| A0A1M6T761 | 335-503 | None |
| A0A350UMS5 | 4-196 | None |
| A0A6S6M4E9 | 2-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.