DPCstruct | MC2383
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 98 ± 8 aa |
| Standard deviation of domain lengths | 8.11 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 27.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B7D581 | 5-108 | RSDLSWWLELAGTLDWTFAKTYSETAPHEYVVEGRTEGVTHVDMVRASRVIHTFGAPGKYYSLTKIYLVSPGGRFRWWTEDNHLTDT… |
| X1JC01 | 3-94 | KFSNELKGFINNTQWIFAKTYAATWPHHYIVRERVDENLFLKMVKHIRCFGYEGPFYKQKYIYFEEDGLVYWTMGAPVEETTIINRC… |
| A0A838JWM8 | 102-203 | None |
| A0A7V9DN45 | 3-110 | None |
| A0A2G3E1Z8 | 12-113 | None |
| A0A382T8W3 | 9-118 | None |
| A0A6N8UQW3 | 2-92 | None |
| A0A5C8HN76 | 2-100 | None |
| A0A7J9XCV8 | 25-116 | None |
| A0A7W4E7Z6 | 7-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.