DPCstruct | MC23829
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1219 |
|---|---|
| Mean domain length (aa) | 115 ± 21 aa |
| Standard deviation of domain lengths | 20.68 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 78.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 14.35 |
| Pfam Score | 95.13 |
| Assigned Pfam label(s) | PF16273- CL0052- CL0552- PF12999- PF14913 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J4K8J9 | 15-98 | WVAEQNEQQVIVYFRIPEHLDYRDIEVLTNDNQTAIMVRLGDNLPFFAGTCYAEFPCYTESLSPGLFVLYMEKKEEEIWPIIIK |
| A0A7C2Z490 | 7-109 | FRYEPLADLIDRGTYYLVTVDLPHVNKDNIHIYLDDDTVLIHAENEYTSDDGSYNRVVYDREFTLPDDADSSTIRVSFKEGMLRITM… |
| A0A3N5WM47 | 17-117 | None |
| A0A1D1YA20 | 33-171 | None |
| B9ENZ4 | 113-197 | None |
| A0A7S4PLI7 | 295-412 | None |
| A0A0R3U802 | 6-119 | None |
| A0A497I667 | 42-132 | None |
| A0A832ZW27 | 122-204 | None |
| A0A2N9IBN3 | 31-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.