DPCstruct | MC23828
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 126 ± 25 aa |
| Standard deviation of domain lengths | 24.78 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 80.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 52.52 |
| Pfam Score | 82.75 |
| Assigned Pfam label(s) | CL0113- PF05180- PF08069- CL0600 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A098VV23 | 174-306 | GISDSALPYRRSAPSWVKTTSLEVSDQIFKLAKKGLTPSSIGVVLRDLHGIPQVKSITGNKILRILKAGGLAPEIPEDLYHLIKKAV… |
| A0A7C2YR58 | 8-137 | GKSQSKRPLGQLQLVEGNPVTPEELKEKIVSMRKQGLSKALIGQKLRDEEGIPSVKRILGKSLTGALKEEGEKEAVPEDLANLISKK… |
| A0A166AKB9 | 9-91 | None |
| A0A813QS80 | 10-149 | None |
| A0A4Y1QZW5 | 6-131 | None |
| A0A6A5SN26 | 1-123 | None |
| A0A0B3B385 | 18-123 | None |
| A0A146HBY4 | 83-224 | None |
| A0A5A7VKU6 | 71-203 | None |
| A0A7J3CS43 | 4-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.