DPCstruct | MC23827
Metacluster Properties and Pfam Annotations
| Number of structural domains | 429 |
|---|---|
| Mean domain length (aa) | 359 ± 81 aa |
| Standard deviation of domain lengths | 80.63 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 79.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 15.70 |
| Pfam Score | 95.00 |
| Assigned Pfam label(s) | PF08619- CL0142- CL0063- CL0020- CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q5HF06 | 2-321 | KKIIEWFINLYAIWIILAFIVGYLYPGAFMWFTKGSWMTLALAVVMLSMGLTLRVEDFKALFATPRVVLIAAISQYTIMPLSGWLVA… |
| A0A7C0ZUK0 | 23-394 | EYLSRKHIPMVLGELFLGVLLAAIFGVISEDLLEACGSEIYDVFSLLGIMFLMFISGLETDVGYLQRSLKYGLSVALLGSVVPFALV… |
| A0A432FFC5 | 6-331 | None |
| A0A177KUH8 | 4-283 | None |
| A0A2I0NCQ8 | 155-378 | None |
| A0A6A6L5R3 | 227-534 | None |
| A0A3M1B951 | 30-516 | None |
| A0A672Q737 | 2-280 | None |
| A0A0G4HHY8 | 293-720 | None |
| A0A378AL23 | 180-508 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.