DPCstruct | MC23823
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 108 ± 10 aa |
| Standard deviation of domain lengths | 10.38 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 24.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J8APB5 | 47-154 | LEDQSMQKIEFFFMTGGEIKCPIEGCTVGRFTSKCKFTRHWTEKHVKTSIKYHCSIRNCTVTCRRRYDMKTHIKEVHRAEDRLLIED… |
| A0A210R730 | 8-110 | VSEEEIAVIQQDTRSVWVVRKIKVYSGMLRHWAEIHARTVQRVRCPRCSFFHIRKNQVVRHVRHEHKVEAAEAVRMVAPGERVPNNR… |
| A0A3S0ZSG5 | 27-130 | None |
| A0A8B6HJA0 | 8-119 | None |
| A0A8B6HIY4 | 13-115 | None |
| A0A8B6HBG9 | 12-120 | None |
| A0A8B6BPV2 | 79-203 | None |
| A0A210PKI2 | 1-89 | None |
| A0A8B6EPF4 | 8-124 | None |
| K1PVU0 | 13-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.