DPCstruct | MC23821
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 296 ± 49 aa |
| Standard deviation of domain lengths | 49.11 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 72.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 20.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L8GD86 | 1-259 | MAAKITRFLAYSLFRFILPLTLLIGCLVRYSGLSLIYGILLLLTPLFKSPTIESLHGATGHFLKAVLAISSLIFLSQSLFHIVLVSI… |
| X1X5I4 | 33-309 | SSGMFLRTVTLISWLMVLIQLLFQIVLLVMHPYGKILEPTCSGVERMFRYIGLIELSKLQLVEILYFYLPELIMVCASTIIQRMLIK… |
| A0A7R9GZC7 | 20-313 | None |
| A0A3P6TBY3 | 1-372 | None |
| B7QI96 | 1-211 | None |
| A0A1S3QTI3 | 1-331 | None |
| A0A2A2M0E5 | 100-375 | None |
| A0A2R7W990 | 341-703 | None |
| A0A7R8ZB90 | 47-415 | None |
| A0A1J1ILZ0 | 25-300 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.