DPCstruct | MC23820
Metacluster Properties and Pfam Annotations
| Number of structural domains | 930 |
|---|---|
| Mean domain length (aa) | 163 ± 31 aa |
| Standard deviation of domain lengths | 31.01 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 82.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 14.25 |
| Pfam Score | 71.61 |
| Assigned Pfam label(s) | PF05678- PF19445- CL0029- CL0109- PF15253 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A354GTL3 | 14-126 | QDAGVRQVIEQAWLDSLANDPILRHEEGGWIYLDLTSGVLSFIRAIAGATSGISLSAPPTVAGAVVVGKFHTHPNPEIEGWTTGPSP… |
| X1X464 | 6-182 | DQLTDVFISDEVLLMCHNLALLTEKEEVAALLIGQKIIHENGITVSVTALSIPPRGEIKKDRVEIMSEDLVNAMEDAKHFSRVKGAN… |
| A0A7T1MFI9 | 38-188 | None |
| A0A7T1HW96 | 2-157 | None |
| A0A2B4SEM7 | 404-576 | None |
| A0A0F9UKP2 | 16-125 | None |
| A0A1F6BF25 | 37-161 | None |
| A0A377CF06 | 231-341 | None |
| A0A3P9K1K3 | 4-195 | None |
| A0A373B2Z9 | 394-521 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.