DPCstruct | MC2382
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 92 ± 11 aa |
| Standard deviation of domain lengths | 11.24 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 43.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11575 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3R9XT76 | 236-322 | LRAHCGLSPHVLRGNAAAALIGALRVLTTHAPDAPCPPLPLVAGLLAREPLAGAGAFTPRPLTYRRRSCCLYYRVRGGGLCGECVLK |
| A0A3B7D2P1 | 2-84 | LWGNVASSLSGAQTMLAAARPDRAAAGGRIIGGLLDQGVLHGTGDLHGVRPGFVRRSCCLFYRLPSAGVCGDCVLDRAPSPAP |
| A0A7W3T5S7 | 23-118 | None |
| A0A6B3FBD3 | 1-78 | None |
| J7L6G6 | 224-323 | None |
| A0A538MQN2 | 199-294 | None |
| I9KAV3 | 177-287 | None |
| A0A7W9QER4 | 228-348 | None |
| A0A6A0AZU9 | 2-97 | None |
| A0A498DX62 | 122-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.