DPCstruct | MC23819
Metacluster Properties and Pfam Annotations
| Number of structural domains | 142 |
|---|---|
| Mean domain length (aa) | 465 ± 83 aa |
| Standard deviation of domain lengths | 82.93 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 84.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.40 |
| Mean intra-cluster sequence similarity (%) | 15.51 |
| Pfam Score | 50.17 |
| Assigned Pfam label(s) | CL0040- PF00221- CL0404- PF19300 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z9PPD3 | 2-351 | LIGEGEVFHHGQRRPTPDVFSEFGIKPVTLVAKEGLALINGTHLMCGRFALIAQDLRRVTNAAFIANAMSIDAARASHGYLDSRVYA… |
| X1WZ00 | 222-689 | SLAALMIGAVVGSGVAAAKLSPQRWVRWLGEAYSTVFRGIPELLVIYLFYFGGSGLITLVGQMFGADGFIEAPPFLIGALAIGLISG… |
| A0A812ILL8 | 360-816 | None |
| A0A7X3T872 | 6-415 | None |
| A0A2S8BD42 | 34-525 | None |
| A0A135VMM9 | 19-456 | None |
| A0A2A2K5X3 | 309-869 | None |
| K5UM21 | 209-676 | None |
| A0A1V5R4T2 | 35-556 | None |
| A0A814QGP2 | 2-493 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.