DPCstruct | MC23818
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 147 ± 23 aa |
| Standard deviation of domain lengths | 23.17 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 76.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 25.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0001 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R2MQW7 | 1-137 | MTSPISYVKINKAQVEDLVRKNTAVQSRLSNVENSVSTINQIQNTLNTLSTQITALSSRVANLESNSGSPSPSDCCNTVPDRVSTLE… |
| X1WXI9 | 2-169 | CFRSDNGHLCIDSATSRNISLSTKGKGFINVNNENLLQIIGLAKEASELIDSFRSNDLPEFADTINKFVPLIDGPRSLSSRVTALEV… |
| A0A3B0JMN3 | 31-196 | None |
| T1H1G3 | 34-191 | None |
| A0A6V7WZF8 | 38-215 | None |
| A0A3P6Q8G5 | 15-133 | None |
| A0A4Y2M4I4 | 2-109 | None |
| A0A3R7PW76 | 127-247 | None |
| A0A7R8VQM0 | 30-177 | None |
| A0A1I8PEH9 | 27-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.