DPCstruct | MC23817
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 111 ± 17 aa |
| Standard deviation of domain lengths | 17.38 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 77.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 32.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M3J623 | 94-223 | TEELTKLNPQHARARNNVKWYQDLLVKDGVKPSDHRRNIPPLDNQRPDDGMKDSERTIYEALCRNEVPVSVKATSKLYCYYKMDRPF… |
| X1WXD1 | 26-122 | KNELFELEKESTTDIMEVYEYSIGHGYMKDFRNLCKHGVSRTLTKYSKCRYQTNNLFYRILMPFKEEDINSEPLIKIYHDVLYDDEI… |
| A0A815XYW3 | 32-132 | None |
| A0A0B1SSZ0 | 39-170 | None |
| A0A6P4YY69 | 272-355 | None |
| A0A183H975 | 5-99 | None |
| A0A482XDF6 | 145-258 | None |
| A0A0B1S2D1 | 154-255 | None |
| A0A820TY94 | 534-678 | None |
| G3IIM3 | 649-761 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.