DPCstruct | MC23816
Metacluster Properties and Pfam Annotations
| Number of structural domains | 79 |
|---|---|
| Mean domain length (aa) | 154 ± 31 aa |
| Standard deviation of domain lengths | 31.31 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 72.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 29.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0J7JWN8 | 1-99 | MDNVYGVYLGDDGTRLDDKKFDVDVDDAIIIGDVRYIGTPGLYELIFKRIPDDLVYTGNDKLTYRGILLKTNAHKRDHKATMPVLGN… |
| A0A6P7H1N5 | 24-177 | QERTLFLDQYDPLPRKYITEMQADFLNKEFDHKYVVRFDETSEKLLIGNSEINIAGVDVLLKNKRYKGTSGLYELLFKKHPANFTDQ… |
| A0A482WIB8 | 3-201 | None |
| A0A653DIN0 | 113-243 | None |
| A0A6L5DBP3 | 297-463 | None |
| E9II80 | 181-297 | None |
| A0A0J7KGX4 | 1-125 | None |
| A0A0J7KGU6 | 23-150 | None |
| A0A0J7K452 | 25-187 | None |
| A8XLD0 | 36-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.