DPCstruct | MC23814
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 183 ± 17 aa |
| Standard deviation of domain lengths | 16.93 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 76.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 30.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J9LNN7 | 1-189 | MNEFELTTLQTTTKMFGCVYLGLDKPSSPVPLFHLWVEDPQLVVDKNIDMRGSCRRTHQMDHFMFKCLSRFIPTDEVEYKNNWSYTS… |
| X1WRP9 | 60-245 | CPPVGLIDKYEVMTIQTTTTMNGCAYMEKAVLPSLVPLFHLWLERPEKTMVHGHCNDMENMDHFIFECISKENPTNRIDVEKGWKYI… |
| J9LKS5 | 60-228 | None |
| J9L9I1 | 10-184 | None |
| J9KMG6 | 3-166 | None |
| A0A6G0YFT0 | 37-205 | None |
| J9LBN1 | 28-248 | None |
| A0A6G0Z040 | 9-195 | None |
| A0A2S2NHI9 | 43-244 | None |
| A0A2S2PBU0 | 36-207 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.