DPCstruct | MC23812
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 67 ± 8 aa |
| Standard deviation of domain lengths | 7.50 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 91.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 62.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0108 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9D869 | 455-526 | TATGGGTFWGLGSLLTKAKGFDELLALAEKGDHRHIDMLVKDIYGGDYKTLGLPGHVIASSFEVASVNPPCK |
| A0A663DJQ2 | 115-179 | KRVTGTSLGGGTFFGLCCLLTGCSTFEEALEMASHGDSTKVDKLVRDIYGGDYERFGLPGWAVAS |
| A0A6L5DCC8 | 56-125 | None |
| B8NU33 | 117-181 | None |
| A0A4Z0A977 | 172-252 | None |
| A0A183QAE3 | 201-261 | None |
| A0A484MIB7 | 3-84 | None |
| F8NES0 | 341-414 | None |
| A0A6G0RTJ9 | 683-757 | None |
| A0A2D4HK57 | 56-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.