DPCstruct | MC23810
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 80 ± 6 aa |
| Standard deviation of domain lengths | 5.69 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 36.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0061 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A833W3N9 | 1-75 | MDFTTFITKIASRRKSGILRSYAKKFAEHKNAISLANGMPNATTFPFEEISVTYKGGTKVKLTGQDLFSSLQYAP |
| X1WIZ9 | 48-137 | PSYNQNSAIPFTIDYSYFINDISSKRQPSQLREITRVLEKLPPNCIKFGVGVPNVLTFPFKKISVEIITGENIKLQGQELSDALQYL… |
| A0A433DLA1 | 1-73 | None |
| S9Y833 | 1-78 | None |
| D2VD11 | 1-85 | None |
| A0A6F9CSC7 | 1-79 | None |
| A0A146HH23 | 2-88 | None |
| D3B4I4 | 428-503 | None |
| A0A0G2I4F3 | 2-91 | None |
| A0A550C761 | 6-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.