DPCstruct | MC2381
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 173 ± 16 aa |
| Standard deviation of domain lengths | 16.21 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 20.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B7D1H2 | 138-316 | DELIGTVGRAGIALPPLGKWSLNEVQTYGAWSWGTRFVPPQDLYMFYVEPIARQLIEHGPFFAMAHAGHGLNSYGLNLVTASPSGAV… |
| A0A2T6DHN4 | 20-201 | ADALYHAEGLEAPSLPSCVPPLRRLAVRSFGTSALPEGATLYNVNTLLYSILRGHVRPPFAAHGFAGYGLMSQAIHLHVVTPQAVVL… |
| A0A506XSS0 | 48-260 | None |
| K2R908 | 11-183 | None |
| A0A0Q6R673 | 986-1171 | None |
| A0A6J6DVD7 | 202-377 | None |
| A0A1T2CQ05 | 1-150 | None |
| A0A3D1RBM1 | 113-256 | None |
| A0A095VUT3 | 12-187 | None |
| A0A1F6LCB6 | 8-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.