DPCstruct | MC23809
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 309 ± 54 aa |
| Standard deviation of domain lengths | 54.27 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 74.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 24.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11443 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T1LZJ9 | 13-333 | KALTQNNAVSHYSTLSPCLNFFAQGGSLRNQSPSYIHNLFSLAWQENPQLAIQIMAWIYDCRGGCGERDVFYYLFVWLANHHLETAK… |
| A0A251P9T0 | 1-333 | MSKPEAETHPDQLVNNNNNPCLDLFYNVGEEDVHDPAQMEASCNYVKQVLPLAWSHNPLTALKLVCNLLDGKFNLSAFYTAAFWLHH… |
| A0A2P5F1Z9 | 34-455 | None |
| A0A3S3Q3U2 | 57-345 | None |
| A0A5E4F075 | 2-278 | None |
| A0A7N2L4W5 | 92-406 | None |
| A0A194URU4 | 558-882 | None |
| A0A7R9KDJ1 | 89-419 | None |
| A0A7J7DJ48 | 2-249 | None |
| A0A4Y7JE34 | 43-324 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.