DPCstruct | MC23804
Metacluster Properties and Pfam Annotations
| Number of structural domains | 289 |
|---|---|
| Mean domain length (aa) | 240 ± 53 aa |
| Standard deviation of domain lengths | 53.15 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 89.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 17.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0283 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A510ZC62 | 6-247 | SLFISHGSPMLALTRTPAHEFLRELGSHLKPAAVVIVSAHWASRRLMVSVSERPETIHDFGGFPRALFECQYPAPGEPELARRLARE… |
| A0A1D5P0V5 | 318-599 | AGSWYTASGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGSCAAHAYKQVDPNITRKIFILGPSHHVPLSRCALSSVDIYRTP… |
| A0A523E085 | 171-450 | None |
| A0A835J2W1 | 344-580 | None |
| A0A101MEK3 | 6-249 | None |
| A0A0G0T0M1 | 11-202 | None |
| A0A831SL62 | 7-220 | None |
| A0A535YAY1 | 35-246 | None |
| A0A0F7SMH8 | 25-320 | None |
| A0A3M9YGX2 | 11-275 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.