DPCstruct | MC23803
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 57 ± 9 aa |
| Standard deviation of domain lengths | 9.32 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 58.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19462 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N0GJH2 | 2-57 | LCHHNPHCPTADERAAMTAYVAVDHSEQGWCLLCNGVIRFEDGGAIFPDGHVAPGP |
| A0A7H0IA22 | 5-53 | DVPETPVHAHVVAAHPEQGWNLLCDGTIVFDDCGELLPDGRVVAPVGRL |
| A0A6C1BZ05 | 2-64 | None |
| A0A7Z6XC71 | 17-76 | None |
| A0A1X1N3V4 | 30-104 | None |
| A0A4Y8M9U7 | 15-78 | None |
| A0A2W4PSU8 | 99-159 | None |
| A0A1G8S4W5 | 14-69 | None |
| A0A1V0V8H1 | 389-452 | None |
| A0A1C4TKG9 | 111-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.