DPCstruct | MC23802
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 179 ± 28 aa |
| Standard deviation of domain lengths | 28.20 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 89.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 32.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0064 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y4C7Y9 | 5-223 | FVIIVFFAAGLAAGILKFFPESFPVGEVSKWALYLLLFFVGLSVGSDSRFSEIIRTMRPKLLLIPLATIVGTLSFSALAAWLIGLSG… |
| A0A7C0TYZ9 | 2-131 | LPASTVVGSLAGGFLASLLLKVPLKWGLAISAGFGWYSLTGPLLATYSPIYGVTGFLANLTREILTIIFYPLAIKKVPKEKAIVMGG… |
| R5UH17 | 2-108 | None |
| A0A2N1QQA7 | 46-242 | None |
| A8F6S2 | 4-189 | None |
| A0A7J3RYJ3 | 73-270 | None |
| A0A2D8QAA9 | 179-373 | None |
| A9IE27 | 46-239 | None |
| A0A845RLB3 | 3-195 | None |
| A0A015XD68 | 4-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.