DPCstruct | MC23801
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 78 ± 9 aa |
| Standard deviation of domain lengths | 9.18 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 61.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K3KE49 | 1-99 | MEKVLILMLLVILGLANFTVEAAYKAPWRIHTLFSVECGNYFDWQTVGLMHSFRKVKQPGHITRLLSCTDEQKKSYRGMHLAPTFEV… |
| A0A7S3BLX8 | 1-67 | MHVVFSAECNHLFDWHSVALFHSFARVQQHGNVTRLLACAPHELAKYPKTALEMGPTFVHRNMRDDP |
| A0A6P8EHL7 | 259-330 | None |
| A0A4Y7JHW1 | 423-504 | None |
| A0A6A3AW18 | 203-274 | None |
| A0A287M5H4 | 201-272 | None |
| A0A2V0NTF0 | 85-155 | None |
| A0A5B6UQA7 | 9-88 | None |
| A0A446NXD9 | 201-276 | None |
| A0A804N949 | 68-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.