DPCstruct | MC23800
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 106 ± 14 aa |
| Standard deviation of domain lengths | 14.29 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 38.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K3KCQ8 | 3-105 | IYSPISMQSYNMVMSNGEDASFIPVLPSGFSILPDGNSSNKTMVRSDGSGSSGSGGNIGCLLTVGLQMLLISSRQSSKLTNESIVTV… |
| D7T0B8 | 13-109 | TLLQESFTTSDSSYVTFTPVEASSFSMTLNGGDPDNVPVMPSGFSISPDGPTGDEGSLVTIVFQILDGTASPMHFPSHSVGTMYKLI… |
| R7W9T9 | 726-860 | None |
| A0A7C9EJC7 | 59-163 | None |
| A0A1U8KI44 | 107-213 | None |
| A0A1R3KBL7 | 416-518 | None |
| A0A2N9ICH7 | 499-614 | None |
| A0A4Y1RCH7 | 205-304 | None |
| A0A5N5JYJ5 | 234-344 | None |
| A0A6A4NYP8 | 4-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.