DPCstruct | MC2380
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 75 ± 7 aa |
| Standard deviation of domain lengths | 7.01 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 22.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A2B7C4 | 1-84 | MITLDMSSIESTDDEIYSYERGSNGVVFLDGKELKGCVYCNVTKGVAIRVKRELSGLLIVADGCIVHELVFGEIAFQPKGKEPD |
| A0A6I4DS36 | 1-80 | MRISAQKGHPFHNDILHLYLRVFLNGRECDNCIFADEEAGTVKRLRIGSDGLLLTQNGHFVSETVSGSVKLVLKDGAPSA |
| A0A2D8K5D8 | 12-90 | None |
| A0A2R7Q9F3 | 9-73 | None |
| A0A537UER9 | 45-122 | None |
| N2JMN9 | 67-148 | None |
| A0A848I185 | 55-135 | None |
| A0A1E3H1X1 | 2-89 | None |
| A0A1L6J855 | 12-86 | None |
| A0A521ZNJ7 | 1-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.