DPCstruct | MC238
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 294 ± 19 aa |
| Standard deviation of domain lengths | 19.02 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 74.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 20.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A841JN88 | 126-399 | GLLRSASLSVRSSDYRPVGLTLEFAGLERVSVIESEPAAERRVYVPSREPETTVKGESVQDVDPAEDAIEAQAWKLLRSVGGDSGWE… |
| A0A2V9ICG0 | 29-321 | SLPLGPRAARCAPAEVPRALREAWLRFHETELCQGVDAVFSLRKDTMEVWCLVEDEKSYGKFLELIEPLRASYTVAVYVTRLNPEKK… |
| Q02CR3 | 235-555 | None |
| A0A7X2PFG4 | 260-534 | None |
| A0A7W1SZQ0 | 105-387 | None |
| A0A317IFT0 | 124-419 | None |
| A0A838P9Z6 | 618-913 | None |
| A0A7C6A4H3 | 286-624 | None |
| A0A831T9S3 | 58-361 | None |
| A0A7X8YTQ5 | 4-278 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.