DPCstruct | MC23799
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 65 ± 3 aa |
| Standard deviation of domain lengths | 3.04 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 89.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 74.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0043 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A438JIS9 | 24-89 | QDIPSLTAEAAKEHPGVSYVITAPLGLHGLLVDVVNDRIKHCLKHVAGDEAECAVCAGTGKCRVYQ |
| A0A2K3K4T6 | 3-57 | AEAAKQHPGVSYIITAPLGLHVLLVDIVNDRINDCLKQGAGDADECSVCDGTGKC |
| A0A2Z6PH62 | 93-158 | None |
| A0A3L6QC98 | 271-336 | None |
| A0A843UPF6 | 146-211 | None |
| A0A287QHL0 | 1-67 | None |
| A0A0E0JYR8 | 180-245 | None |
| A0A2P6PCM9 | 223-287 | None |
| A0A834WEC8 | 137-201 | None |
| A0A833QHA7 | 73-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.