DPCstruct | MC23796
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 93 ± 8 aa |
| Standard deviation of domain lengths | 8.37 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 37.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0271 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P5G791 | 1-85 | MSTLPDEVWLRILELGAASSILGYRDLCRVAIASRRLNRLSQEPSLWGALLALDFPFSGSETPSKSLYKIKFEKDKARRIAMRRM |
| A0A2K3JMC2 | 1-91 | MSSLPEELWTKILELGIQNSGLTYEDLCWISISCRLLHRLSSEDSLWNHLLSTDFPLFPASSFPYWSSKSLYLLRIKERILIEAAYQ… |
| A0A835IUV9 | 12-97 | None |
| A0A833RSN8 | 1-87 | None |
| A0A833RRY1 | 1-105 | None |
| A0A5N5NGW7 | 324-421 | None |
| A0A3P6FCF0 | 1-106 | None |
| A0A835IWG6 | 7-102 | None |
| A0A835IVP0 | 12-115 | None |
| A0A833VC77 | 1-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.