DPCstruct | MC2379
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 306 ± 60 aa |
| Standard deviation of domain lengths | 59.55 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 67.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.31 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 24.52 |
| Pfam Score | 89.42 |
| Assigned Pfam label(s) | PF00429- CL0148- PF03708- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A674GTV4 | 301-634 | LNESKPNLTKECWLCYNVRPPYFEVIGKPAKIQWSSGSNPRECPWNDQKNHAQGITIQLVTGQGKWIGTVPKNYQPLCNQTTIITTK… |
| A0A7N6BX90 | 3-305 | PPWTSTELTTSVGWLPDSLCCVTFQMPQPRNKTVKPTVMVEGGWWLCGTRAYVTLPHTWSGRCTPVKVSDHTFLVEPIRPEPTRRRR… |
| A0A6P7HFS2 | 202-485 | None |
| A0A667Y4X6 | 212-617 | None |
| M3Z7W6 | 291-580 | None |
| A0A6P5P2A3 | 80-368 | None |
| A0A811XZI1 | 8-213 | None |
| A0A811YUU0 | 187-490 | None |
| A0A670JPB9 | 171-491 | None |
| G3HLH2 | 10-271 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.