DPCstruct | MC23787
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 189 ± 32 aa |
| Standard deviation of domain lengths | 31.53 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 27.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S2ADM0 | 2-183 | LKNDKDRSYFPFDAFKVERWDIEHIASLKDAIPDKTERKQWLNDVKPYFDKNVPGGKNILKNIDSCDIYDDTEFERLFEQVNDHFNY… |
| A0A4Q5PFR9 | 1-208 | MQTEKATFWFPFDKYKLEKWDIEHVNSQTQAIPDSKTYLSWLTDLLEYFTGFNKYSDDHIEGEEQTYREAIDKIITELGKDELTLQH… |
| A0A0B8P9L8 | 81-250 | None |
| U2C8F2 | 10-147 | None |
| A0A1Q2LFW0 | 305-497 | None |
| A0A644XJ18 | 45-242 | None |
| A0A198X994 | 209-394 | None |
| J9GH79 | 96-270 | None |
| A0A1I2B034 | 34-210 | None |
| A0A1U9MAD5 | 452-724 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.