DPCstruct | MC23783
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 312 ± 31 aa |
| Standard deviation of domain lengths | 31.23 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 16.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H9Q763 | 1-293 | MAEFEQPTIVEMTLPLKQGTSRIIRGIKLQGTPMLVDADSGSIYSPHRRGGRIFHEIKDGLFAAIRSKDHILQRYGVTPEGGGELES… |
| A0A2H0TLS8 | 36-354 | PILVHWKTKCQVIWEGKVIKEYWRDDWGLVKYQPGEVLHREWRVANEWEVEEWKDLPEEQLKELGVFRKDGEFSIQIVEKIKDLQAA… |
| A0A0G0Y2Y7 | 1-254 | None |
| A0A7T9I1L5 | 16-354 | None |
| A0A0G1DV54 | 158-477 | None |
| A0A2J0L6H8 | 1-361 | None |
| A0A554INX0 | 157-481 | None |
| A0A1F7U327 | 33-306 | None |
| A0A2M7UPH5 | 35-360 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.