DPCstruct | MC2378
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 168 ± 12 aa |
| Standard deviation of domain lengths | 12.12 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 70.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 56.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08499 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A814LUQ5 | 66-260 | DDTDTPYDLIEHDVAGLSYTVNLPKPDSFDALQLGSDRLRTIIAAFHCNILVRKEDLVKNLDYVANVLEAVHQDETRRLMEEDDGAL… |
| A0A7N6BE15 | 31-179 | RLRCLVKQLEKGEASVVDLKKNLEFAASVLENLYFEETRQGPEDELSDIQSDTVPSEVRDWLASTFTRQRALMLHRSEDKPRFRSIV… |
| A0A3B4V1L9 | 97-260 | None |
| A0A673K2Y1 | 55-220 | None |
| A0A3L8SLZ2 | 4-163 | None |
| A0A444U477 | 134-311 | None |
| A0A4U5VST7 | 313-494 | None |
| A0A671FI81 | 1-159 | None |
| A0A6I9NPT2 | 1-162 | None |
| A0A183ABG2 | 91-253 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.