DPCstruct | MC23779
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 72 ± 9 aa |
| Standard deviation of domain lengths | 9.06 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 91.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 41.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X8DPJ7 | 3-56 | FAMGIQCGACMVTQKQVYNRMKQLLDKNIPISNYGMAIAYVTGIFERSIEIFNT |
| A0A645FJ53 | 1-83 | MLEKIAKGKLEFDFKVGYDFAQDLDSYDFVIHCGACMVNRKSVIQKIEKCKERNIPITNYGLVIAYFTNILEKSVEIFKVDNI |
| A0A645I0U0 | 79-154 | None |
| A0A847YA22 | 1-78 | None |
| A0A645JCP6 | 51-113 | None |
| A0A645DHP7 | 1-71 | None |
| A0A645FDP9 | 22-103 | None |
| A0A2C8F9T5 | 184-261 | None |
| A0A7W8C4M0 | 1-67 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.