DPCstruct | MC23778
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 151 ± 17 aa |
| Standard deviation of domain lengths | 17.22 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 91.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 25.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C6HMQ6 | 150-309 | IRKALAGLVYGDALMLFNNQTKAYEINKGESDALVEQWIQRLSDEMEKGNGYSSSHIKRNLDKMGEEFAQISLNKVKKIKVGIVGEI… |
| A0A645FI80 | 1-163 | MIRQALMALIYGDMIMLLNNQIEPYEVVPGSSKEKITKWVNYLTHEFSLGKGLSYKDMKKNLKNMVTDFDSIEKEKKDKIKVGIVGE… |
| A0A1V4XIX8 | 50-209 | None |
| A0A661M9B5 | 198-357 | None |
| A0A1B9LYG4 | 1-121 | None |
| A0A1W1USC1 | 227-353 | None |
| X1PTB2 | 1-189 | None |
| A0A0F2IW88 | 405-553 | None |
| A0A3M1DAI1 | 246-392 | None |
| X1F644 | 42-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.