DPCstruct | MC23775
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 236 ± 53 aa |
| Standard deviation of domain lengths | 53.01 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 83.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 22.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A368NDL2 | 44-260 | VGVGAAVVVQRVAVPVYCGAFVGMTSPEVFGSYWQVTLAAVLAGLLFTAAHPVFHGLGGKLGTTAFVGVSLVAVPTAGSFQRGALPG… |
| A0A645F490 | 2-222 | VGLLGPLLAPKLQRAIFCGSFAGMATSMIFTNIWWVGLAGFLSGLLLAASREIYDGFGGKLGAAGFFGTITTALLSDRFIYNNQLGD… |
| A0A7J6QLS4 | 119-418 | None |
| A0A5J4G062 | 15-162 | None |
| A0A3S0EXT6 | 47-336 | None |
| A0A1V3RKI5 | 31-206 | None |
| A0A6G6YI01 | 9-181 | None |
| A0A1V6BXT2 | 12-292 | None |
| A0A812MVV2 | 109-369 | None |
| A0A0V0R613 | 254-510 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.