DPCstruct | MC23774
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 89 ± 8 aa |
| Standard deviation of domain lengths | 7.55 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 92.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 41.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A645F360 | 2-95 | GEFMKLTKIPIIIYYGDFIPEQPSDNPGIDGWRARLEMAKLWRDTVNKYGGDVTLIHLPEIGIKGNTHFPFSDLNNVEIADLLSEWL… |
| W4UY73 | 121-211 | FMKLTQIPIVMYFGDYIPEEVTHELGAENWRTRLTLGRLFVEAVNRHGGDATLVELPKIGIYGNTHFLMSDLNNIEIADLLSAWMKE… |
| A0A6S7DF58 | 4-79 | None |
| A0A4Q0M2P2 | 43-140 | None |
| A0A327XTF2 | 44-136 | None |
| A0A6J5DNA9 | 14-103 | None |
| A0A1Y4D660 | 1-87 | None |
| A0A7K3K9X2 | 474-563 | None |
| A0A7X4H9B3 | 488-582 | None |
| J1GU74 | 4-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.