DPCstruct | MC23772
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 76 ± 6 aa |
| Standard deviation of domain lengths | 6.09 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 93.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 30.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V7XCW2 | 181-258 | IRRPAQPMMVLMHYPPFTSEGNPTAYSRLIEQYAPAQCLYAHLHRPSEWEAAVQGEHNGIYYRLISSDYVDMTLQKVW |
| A0A645EYB6 | 1-87 | MKRDGEPLIVLTHYPPVDHLGRTTPMTELFEHYGAGHVFYGHLHGAANACAFDGTIGTVQYHPVSCDGLGFRLYELALEDPAVAAGG |
| A0A7X5EJ23 | 153-231 | None |
| A0A133Y754 | 198-273 | None |
| A0A7W1HH07 | 70-146 | None |
| A0A7V4EFI7 | 97-173 | None |
| A0A3C0VG13 | 453-516 | None |
| A0A645F2W7 | 1-79 | None |
| A0A6M1YK19 | 1-67 | None |
| A0A7X7M739 | 15-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.