DPCstruct | MC2377
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 138 ± 26 aa |
| Standard deviation of domain lengths | 26.05 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 69.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 28.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05741 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S4P9J3 | 70-194 | NSLMDLEPPKKPTGFQPRNTPEARPRLDFDNKMCMERAALLSLSSTQFSLLLKYVDTLRQQRMSSQKQIECGFCKNNRQPEVWYTTH… |
| A0A7N6BAI5 | 12-140 | ESDSNGFQPWRDYMGLSDTIREILGRNRATDFSLVVSPTRRSKVTRFKTPEQQSLPPSPERMFCSFCKHNGESELVYGSHWLKNQTG… |
| B7PFP0 | 1-82 | None |
| A0A1S3IMS3 | 37-156 | None |
| A0A250KA99 | 10-174 | None |
| Q09597 | 101-302 | None |
| A0A226F0R8 | 155-295 | None |
| A0A821XYN7 | 376-529 | None |
| G0P9V2 | 1-145 | None |
| A0A821UVL0 | 91-254 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.