DPCstruct | MC23769
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 114 ± 10 aa |
| Standard deviation of domain lengths | 10.20 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 92.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 38.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A317F0I7 | 356-470 | KGNFLVIPTDCPQRDERLGWVGDAQVFARTSAFNFDVNPFFSHWMKDVAIDQRKDGAVAFVSPNVLDDTAVGSSGWSDVATIIPWTM… |
| X1JBD9 | 1-94 | MSIPTDCPQRNERMGWMGDAQLVAEEAIYNFDMAGFYTKWLDDIRDSQAEDGSVPDVVPPYWSFYPADPAWGTACVIIPWYLYQYYG… |
| A0A7V9YK80 | 95-206 | None |
| A0A354I0S9 | 561-665 | None |
| A0A6I2P1F8 | 702-811 | None |
| A0A2K0WE14 | 208-316 | None |
| A0A7Y0PFT5 | 332-436 | None |
| N4VF34 | 522-633 | None |
| A0A814UC58 | 211-324 | None |
| A0A1V6E630 | 15-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.