DPCstruct | MC23764
Metacluster Properties and Pfam Annotations
| Number of structural domains | 86 |
|---|---|
| Mean domain length (aa) | 244 ± 36 aa |
| Standard deviation of domain lengths | 36.11 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 22.78 |
| Pfam Score | 96.57 |
| Assigned Pfam label(s) | CL0159- PF10162- PF15711 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G3YZU4 | 16-255 | NGSWFDPNTWKGGKVPGNGAHVMIESGINVRYDRKSNARLKTVRLDGHLTFAHDKNTKMVVDTFIETPTGTLNIGTAAKPIQADKTA… |
| A0A7C3K564 | 114-407 | TPTVTPAPAPTPGPTPAPTATPQPGTRRWSNPSSWPTGRVPTRNDNVVIPAGLTIEVDVTTAEARTVTVDGVLRASRSVPSTLTVYG… |
| A0A183WM88 | 1-164 | None |
| A0A7S1VAV1 | 242-503 | None |
| A0A388KP59 | 454-649 | None |
| A0A813VGQ8 | 60-335 | None |
| A0A7V8ZH07 | 305-549 | None |
| A0A2D6E5T0 | 250-505 | None |
| A0A4V3HH68 | 33-322 | None |
| A0A7S2XQU3 | 22-273 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.