DPCstruct | MC23761
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 560 ± 129 aa |
| Standard deviation of domain lengths | 128.60 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 80.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 16.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A2T3L8 | 23-708 | SPQIQALAQSLGGNPFKIHQWVHDHIHFHPSHGSVQGAQDTLDKQRGNAYDTASLLIALLRSSGIPARYVYGTVDIPIAQVQNWVGG… |
| A0A7C2HXX3 | 23-593 | VDRLFAFLRDAVAYEPYPGVLRGARGTLLAMAGNSPDRALLLAAMLQAGGRRVRFARGTLDEARARALVTSAWAPRPDPGSATPAAT… |
| G8LY28 | 1-358 | None |
| A0A2V8I267 | 39-556 | None |
| A0A373PSV1 | 156-767 | None |
| A0A290ZQ42 | 60-666 | None |
| A0A250KVJ8 | 63-489 | None |
| A0A1V1P5S1 | 6-353 | None |
| A0A356CWG7 | 23-342 | None |
| G8LWN6 | 241-888 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.