DPCstruct | MC23757
Metacluster Properties and Pfam Annotations
| Number of structural domains | 154 |
|---|---|
| Mean domain length (aa) | 431 ± 77 aa |
| Standard deviation of domain lengths | 76.84 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 76.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 13.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20178 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A127HRI5 | 35-310 | VTLPAERSALETTNATLKRVNTAYEQQAQRLYADLEHSDLSQAGGQQRLATLKTRLVQQLQRLDETSTVDGQSRKTFMTFTAGISAL… |
| A0A5E6UBD4 | 45-459 | ADPVRLGEFRALLDEALPYQNYIDKLLSKLETLEDFCKRKLGLALQQQYGGRFSVDDSIRLQPATAVDDDSHTYTLLQAAMLNFTQQ… |
| A0A656YQ40 | 213-746 | None |
| A0A486XNJ1 | 124-513 | None |
| A0A0P8WNJ6 | 3-316 | None |
| A0A0P8XEB0 | 265-697 | None |
| A0A0N9JNY6 | 6-430 | None |
| A0A105VBW3 | 82-528 | None |
| A0A3G7U854 | 57-334 | None |
| A0A2N0DY02 | 162-485 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.