DPCstruct | MC23755
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 250 ± 16 aa |
| Standard deviation of domain lengths | 16.29 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 65.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 29.94 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | CL0229- PF02178 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A482SG36 | 1-236 | MSESVGKRQRKTRVAFEPEDFTAKKQRKGSTQASDRPVSTSKKARNEAVAGSTNKWKVYYNLIKRAADLVVREEHFIEVRIQTGGNN… |
| A0A0D9V5L4 | 324-573 | SASKKKNETPKAPVNDNTAVQQAAKKRKRNKPLKPVHSSLKVLPSASKRKTKARNELVNEDVGVQLAVKKRKVGRPPKGETPKDDYL… |
| C1MVF1 | 5-249 | None |
| A0A485K5R0 | 168-430 | None |
| A0A2R6WKY9 | 131-394 | None |
| A0A446W5G5 | 1-274 | None |
| A0A835Q8R9 | 67-317 | None |
| A0A3P5YWI5 | 100-314 | None |
| A0A388KHU5 | 501-751 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.