DPCstruct | MC23754
Metacluster Properties and Pfam Annotations
| Number of structural domains | 84 |
|---|---|
| Mean domain length (aa) | 193 ± 32 aa |
| Standard deviation of domain lengths | 32.49 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 86.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 35.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A024SC02 | 121-348 | LLGGIVITWYVTKTPIPDAYATEIKNYITARAHPEDGGWGLHIEGESTVFGTAMNYIVLRLIGVDAEDPVMVKARATLHKMGGAVNA… |
| A0A446UXH5 | 8-198 | HQNEDGGWGMHIEGHSTMIGSSLNYVALRLLGEGPNGGDGAIEKGRNWILDHGGATFAPSWGKFWLLVLGAYDWSGTNPVPPELWLL… |
| A0A0D3C1E0 | 3-171 | None |
| A0A067KLI9 | 1-164 | None |
| A0A835IJW9 | 455-707 | None |
| A0A5N5JBD8 | 29-209 | None |
| A0A5N5J6F1 | 228-433 | None |
| A0A067JM13 | 131-309 | None |
| A0A7V8VDQ5 | 60-274 | None |
| A0A5A7QXW6 | 391-634 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.