DPCstruct | MC2375
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 64 ± 5 aa |
| Standard deviation of domain lengths | 4.58 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.64 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 44.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0263 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A023CP01 | 1-70 | MGESKRNNHAQKVAGREDRLPDDEGGHLIATIFKGSGGLDNLVPMNGNLNKGEWKKLENTWAKALGQKNQ |
| A0A6G8JAM9 | 61-124 | LKLDPNDRNTYQQRISGGECRLDTDCGGHLLASMFGGAGEKINIVPMDAILNGAKGKWYQMEMQ |
| A0A1H1NMV7 | 102-170 | None |
| A0A2A7MI77 | 501-565 | None |
| A0A1R1GAH5 | 984-1051 | None |
| A0A510JFG0 | 453-517 | None |
| A0A2T4HKX8 | 241-308 | None |
| A0A418KZ98 | 1056-1118 | None |
| A0A7X9M422 | 2-53 | None |
| A0A7V8U8Y7 | 153-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.