DPCstruct | MC23746
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 135 ± 16 aa |
| Standard deviation of domain lengths | 16.42 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 93.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 38.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6F9CLH3 | 150-259 | YAAFPDFFMTRTATWWHQEIADFYHNTMKFDGLWIDMNEPSSFVHGTVGEKCLGPAVYDMPPYMPPLESRHRGLNHKTMCMNSQQHL… |
| A0A7F8QF11 | 1-120 | LYRAYVAFPDFFRNSTTTWWKRELQELYTNPQNPERSLKFDGMWIDMNEPASFVNGAVPPGCKDATLNHPPYMPYLESRDRGLSSKT… |
| A0A0M3IL07 | 1-150 | None |
| D3ZTX4 | 1319-1437 | None |
| A0A0M3ILY6 | 110-257 | None |
| A0A0B2W2F9 | 111-261 | None |
| A0A0P4VSC2 | 62-193 | None |
| G0PAM2 | 762-884 | None |
| A0A1D6LPR4 | 18-120 | None |
| A0A0A9D8A7 | 68-217 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.