DPCstruct | MC23744
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 174 ± 18 aa |
| Standard deviation of domain lengths | 17.91 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 68.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 22.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09172 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7F8QCJ9 | 1-202 | MDFSKFSRNYQFSKSVSLPSLDPVSVKIEGNLIFDPNNYLPKESMLKTTLSVFGFAPADLFEIGLEGKGFEPTLEALFGKQGFFPDS… |
| A0A7R9ITR2 | 314-465 | LTPEQFGLQYTRSSVRSYESEKMNLGFKQQVNYIGSNDHIIPSALVYHLRHDLGGHSRRYMSFGAMTSSVDDLLDALLKQIGESEYS… |
| K1Q0V4 | 13-164 | None |
| A0A7R9BAD1 | 85-280 | None |
| A0A7R9B8J5 | 295-460 | None |
| A0A3Q0J1X1 | 1-197 | None |
| A0A5B7CUZ6 | 346-512 | None |
| A0A2R7WZH9 | 30-209 | None |
| A0A6H5ITV8 | 771-934 | None |
| A0A0M3IYH2 | 336-495 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.